web counter
www.briansprediction.com© and www.BriansPrediction.com© Brian Ladd specializes in dream analyzation, dream prediction, remote viewing and more with thousands of documeneted dreams that have come true...the largest personal online dream diary in the world. Brian does not claim to be psychic, he insists we all can predict the future using our dreams, and much, much more.www.briansprediction.com© and www.BriansPrediction.com© Brian Ladd specializes in dream analyzation, dream prediction, remote viewing and more with thousands of documeneted dreams that have come true...the largest personal online dream diary in the world. Brian does not claim to be psychic, he insists we all can predict the future using our dreams, and much, much more.

Brians Dreams
Homepage,where dreams really do comee trueMore About Me and my familyRadio ShowInterviewsBrians Cards and
LettersMissing People Dream
ViewingsFound
PeopleEarthquakes DreamsAlerts and Currect
Warning

Dream Discussion Forum TV Archives Dreams via email

Additional posts on this page will be made available via my Facebook Site.

PAGE 1 | PAGE 2 | PAGE 3 | PAGE 4 | ALPHABETICAL ORDER | FULL LIST WITH PICS | CORRECT CASES | MP TV | POST INFORMATION ABOUT THIS CASE | TEAMWORK CASE ARCHIVES | MISSING PERSONS RADIO | MP NEWS | OTHER RV'S | FBI TOP 10 | PLEASE HELP, JOIN THE FORUM FOR THIS CASE CLICK HERE REQUEST TO OPEN A NEW CASE  |  MP WEBSITES

Caylee Anthony - opened 7.20.2008

page 3

case links: page 1 - page 2 - page 3 - page 4 - page 5 - page 6 - page 7 -page 8 - page 9 -  Nancy Grace / Additional Info - radio show - forum

 

9.4.2008

MESSAGE FROM THE SEARCH COORDINATOR: 

Brian, 

Hey everyone, this is Wyatt.  I have been working directly with Gale and her team here in Orlando searching for Caylee Marie Anthony.  We are so excited to have had the opportunity to work with her and since we have not found little Caylee and we really need Gale and her team to stay.  We need all the help we can get. 

If you can’t come out and volunteer and would like to help out in any other way, please call me---wyatt@.  We desperately need Gale and her team to stay at least another week.  With TES and Gale’s team looking, we should be able to find little Caylee and soon.  We would appreciate any help you can offer.  You can also e-mail me directly at wyatt@.

Thank you in advance.

Wyatt Locke

Search Coordinator

wyatt@

reply

Thanks Wyatt, will get the word out...and great job :)

Brian


Hi Brian,

I have been following your site for quite awhile and have been quite
impressed. My heart goes out to you. I can sense your discouragement
along with the rest of us in which our hearts have been touched so
deeply. From the beginning I have fought the argument steadfast that
little Caylee was alive while everyone else around me thought I was
crazy. I am a professional single woman with 3 small daughters and the
thought that a “normal” person (yes, I admit – I was stereotyping)
could do such a terrible thing – was something I did not want to admit.
Understand that from the second I saw Susan Smith on TV – I knew she
was responsible – but, something about Caylee (perhaps because she
looks JUST like my youngest) – I refused to go there. After hearing the
results of the air samples, my heart sank and I had to realize, I guess
I am probably wrong. Now, every day that goes by, the new findings just
get more and more bizarre. It is beyond a CSI episode. I now am guilty
of wondering what is next rather than my initial heart breaking
yearning for Caylee. I don’t like what I’ve now become as a result of
all this craziness.

That being said and I admit this next comment is a contradiction to the
above……I notice nobody has mentioned on your site today what Leonard
Padilla said within the last 24 hours…..

http://www.540wfla.com/cc-common/mainheadlines3.html?feed=227698&article=4189759

Extremely disturbing, as I thought Lee was possibly the only sane
person in the family. If this has any merit to it.....it would explain
a lot. The police having the DNA results that “Cindy, Casey & Lee” (Not
George) were informed about last week. Detectives may use this to say
“Hey look, we know what is going on here, do you really want this made
public? Here is your opportunity to talk.” Absolutely unreal. I
hesitate to even mention what one of my co-workers mentioned to me
today. “I always thought it was weird that she used her and her
brother’s name to name her daughter.”  Cay – Lee.

Never caught that one.

Good luck with your search and may we bring Caylee home soon.
Shelley

reply

Thanks Shelly, I agree...it's getting really crazy.

Brian


IMO, your dogs continue to display a bad example for legitimate cadaver dogs who hit on actual dead or decomposing  human bodies ........By your dogs simply alerting to dead animals, such as yesterday and again  few weeks ago, show just how unprofessional and untrained they really are. Your dogs continue proved the Anthony's theory concerns, "that cadaver dogs hit on dead animals" and "that's probably what the cavaver dogs hit on in their backyard and outside of Casey's trunk".
 
Send the dogs back to school and your embarrassing yourself!

(Deuteronomy 18:10-12) There should not be found in you anyone who makes his son or his daughter pass through the fire, anyone who employs divination, a practicer of magic or anyone who looks for omens or a sorcerer, 11  or one who binds others with a spell or anyone who consults a spirit medium or a professional foreteller of events or anyone who inquires of the dead. 12  For everybody doing these things is something detestable to Jehovah, and on account of these detestable things Jehovah your God is driving them away from before you.

response by Gale is in this audio recording.

this is the dog in question


Brian is there anyway we can see Gale and her Team back on Nancy Grace before they go home??

WE MISS SEEING THEM!!

Christine

reply

Hi Christine, talked with Gale and they don't have a problem doing the show...the reason why Gale cancelled on Thursday and Friday was because of having to go to and from the studio at Universal.  The team has no problem doing an interview while out searching...so if you want to see them back, would suggest you contact the show directly...but the show goes on at 8pm, and they do not work weekends, so it might be too late.  The teams going home on Monday.

Brian


Hi Deb pray you all are safe and blessed well today and that God's love & light will show the truth as God knows it for Caylee. Brian keeps seeing 317 now there are 5 Anthony family members and two of Casey's boyfriends were named Anthony that equals 7 Anthony's (3) who were involved and 1 that was lost Caylee?? This will not leave my spirit alone and don't know how to post it to the website! Peaceful blessings Mary Ann Kipuros

reply

HI Mary, still not sure what 317 means yet, but thanks for this.

Brian


reply

Hi, yes, but I don't  think its going to help us locatee Caylee...but it's a Friday.

Brian


Sue has sent you a link: "Casey Anthony Released From Jail, Whisked Home - News Story - WFTV Orlando"

The link:  

http://www.wftv.com/news/17393803/detail.html?treets=orlc&taf=orlc

Message from Sue:  Now look at what is hitting the sites. I tell you it is still all about Casey and not where it should be on Caylee

reply

That's the way the media seems to wants it.

Brian


Just a thought, Brian,
    But since Cindy Anthony claims to be a spiritualist/or have ties to that, has anyone considered having Gale ask one of the psychics from Cassadaga Spiritualist Camp near Deland, FL. talk with Cindy and join in? It may loosen Cindy up a bit and get her to cooperate better.
     There was a case here in central Florida not too long ago where a grandma and grandson went missing and they (psychics form Cassadaga) got the place correct where the body of the grandson would be..although they did not recover the grandma. Of course..the police kinda blew them off? -But that WAS where the one body was found. (Where the spiritualist from Cassadaga thought it would be.)
     Again..just a thought. But I am sure they are already discussing this case in their community anyway and the goal here is to find little Caylee, right? Possibly they could help!
                               My best to you and all those you work with!
                                                         -Mrs. L.A. Perry!

reply

Hi, not that I know of...will ask Gale.

Brian


madelien mccann case

hi brian hope alls well, i have sent you a link to watch, hope it works http://www.thesun.co.uk/sol/homepage/news/maddie/article1651651.ece

leigh

reply

Hi, thanks...I'm going to post this in the Caylee Anthony case too, she's a missing child out of Florida...are the McCann's watching US News about this case?  Very ironic this would come out now.

Brian


have you also heard about the book/movie offer and 20/20 paying for interview? it is horrible that these people get to benefit from poor Caylee... this news.. is it pertaining to what you refered to earlier about not being able to tell us exactly what was going on.. either i missed you informing us, which I have read the pages or you havent explained yet.. I am lost on that one still..

reply

Not about 20/20...how much are they making?  

Brian


Brian

 

I have checked your site daily, and hesitated to contact you about the dream I had weeks ago. I have often had what I call vision dreams, that stay with me forever and do not fade. Tonite I saw a map of Moss Park Rd on your site that someone sent to you and I googled it so I could do a satellite image. I wanted to enlarge the image by the bridge and move southwest of it because my  Caylee dream has these elements: a bridge, a dirt road, a section of trees and then a baseball field. I was quite amazed to see all these in this map. In my dream I was riding in a white golf cart,

with a pink helium balloon tied to the left side of the cart, and I went over a bridge onto a dirt road that ended. I turned around and took a left turn onto a dirt path that had a wooded area on the left. This path lead to a large open area and as I looked left I saw a baseball field. I was actually located at the far end of right field, well past first base. The enlarged map of Moss Park  Rd shows this scene exactly as my dream. I do not know if Caylee is here, but

the connections I made weeks ago were through my dream symbols. The pink balloon (Caylee had a birthday and I did not know this at the time of the dream), the white golf CARt ( Caseys white pontiac),and  the baseball field, which I thought represented Casey as in a poem from high school (CASEY at the Bat).There is also a golf club located nearby to the west . I am sending you this because I know you will read it and I just can't stand the thought of not helping find this child. I am still amazed that I was led to your site and that I kept checking to see if anyone else had a bridge in their thoughts, and that I found a kindred soul here who did.

  

may you always have peace, love and laughter

 

patti  

reply

Hi Patti, thanks for this and the team will check it out before they leave.

Brian


Hi. I have been lead to your site and have been very intrigued by
everything I have ready about this case. I am not a psycic and I don't
have dreams but something has been stuck in my mind since I have ready
through all the posts.

**SOMEWHERE on the two pages (and I can't seem to find it now) either
you or another post metioned a recycling sign and I saw the drawings of
it. I just ran across this story on foxnews.com. You can access it with
the following link:

http://www.foxnews.com/story/0,2933,416882,00.html

- Do you think your dream was about this case and not Caylees when you
wrote it down? Just stuck in my mind and curious.

**Also, someone had shown a map on your first page of the Walmart off
Le Vista Blvd. and Goldenrod...two things you had mentioned. Also
someone else with these dreams (perhaps it was you) said that she is in
a place where a lot of people go...she should be found soon because
it's not off the beaten path (in my own words) -- hard to search
through all those posts at 11:30 at night. :-) In the map it looks like
a body of some kind of water across from WalMart (where many people are)

Do you think there is a link? I hope I'm not wasting your time but for
some reason had to mention it.

Take care and thanks for all you are doing. Good night

reply

Hi, I do not know, I think that is on page 2...and I reading the article right now.

Brian



Brian:  I've been following this case for the last 11+ weeks....  I check your site daily to review the new postings.  This week, there were two entries concerning Moss Park Rd.  According to the satelitte directions, you have to use 417 to connect to this road.  When I put in the Anthony's address, it appears it's only about 10-12 miles from the bridge noted in one of the postings.

 

Also,  I found some of the roads around this area with 'flower' in their names, Flowering Cottenwood Rd, Jasmine Flower Ln., etc.  Plus, there are two roads with 'Lake' in their name (Lake Heart Dr, Lake Mary Jane Rd - last cross street before the bridge).  There are several 'bodies of water' in this area following Moss Park Rd, down towards where the bridge is located.  Past the bridge, there is a roped off area for swimming, a boat ramp, plus several different buildings.  One building looks like it's lighter (white) colored, possibly cinder-block.   A little farther down the road (on the right), there appears to be a baseball diamond, plus another 'structure' that I cannot determine what it is. 

 

When I found all of this data (especially the flower rd names/ lake rds/structure), I had a chilling feeling this is where little Caylee is..... please have Gale/team check this out. 

 

May God bless you and your entire team......

 

BJ

reply

Thanks BJ, will do.

Brian


Brian,

I admire your strength and ability to persevere when you must stare such darkness in the eye every single day.  You are all such amazing and resilient people.  I take great comfort in your calmness regarding the Caylee Anthony case.  I believe others do, as well.

You mention that you believe Caylee's body will be found soon.  I'm convinced that the Anthony family will then blame the alleged babysitter/kidnapper for her death and the disposal of her body.   Will the denial and lies ever end?  It is so unbearably toxic to everyone who has followed this case. 

A curious note…there is 317 Kayley Street in Orlando, FL.  It happens to be a recycling center/landfill service.

Thanks again for all you do,

Kelly

reply

Hi, I'm sure there will be all sorts of blaming going on after she is located, just like they have been...will take a look at that address.

Brian


Hi Brian,
 
I really enjoy your site and want to thank all of you for helping missing persons be found. I have a quick question. Could it be that Caylee my not be dead. Could it be that Casey was selling meth. and you use chloroform in the making of meth. and the place was Dante's apt. at the sawgrass apts. If his apt. # 317 (I don't know) and that Casey stolen money from these people and they are keeping her or they killed Caylee because she stole from them or Caylee accidently got poisoned. I guess that they would not find decomposing remains if someone wasn't dead, but she had to be going somewhere when she said she was going to work. Maybe she left Caylee at the lab and something happen when someone else like Dante was watching her. Maybe there is more to the sawgrass apts. or 317 is the apt. where it happen. Just a thought. God speed all of you for your efforts to put closure in peoples life. I am so sorry people are so hateful to such wonderful people like you, Gale and the rest of the team.

Thank you for your time.
Barbara

reply

Thanks for your time too...I hope she's not dead, but everything seem to point to that.  It might be possible that Caylee accidently ingested meth, but I'm not sure how much it would take it kill her.  I say let the CIA make Casey talk...they have the experience.

Brian


Hi Brian,

I see that you are having trouble with the number 317. If you turn it 
upside down it
becomes LIE.
Just a thought. Please don't publish my email information.
Keep up the good work.  Joan

reply

Hi Joan, yes it does...did not realize that.

Brian


Brian

 

Just a thought here..... Casey drove around for day with her in the trunk after she was dead..  Then  borowed the shovel to bury her at the Anthony home.......DEEP in the back yard .  Maybe she lay Caylee down while she dug the hole.......thats why dogs hit on the yard.  When the neighbor saw her backing into the garage it was NOT to remove the body but to place it there.  I just feel when Casey said she was close to home....she really is.  They have flowers all over the yard......the white building could be the storage sheds in the yard.  No one is worried about where they are searching because they are done searching  the house......  Maybe the whole time she was telling people caylee is with the granparents......she was and is very close to the house.  Wonder if Gail could go by the house and see if she could tap into something. 

Wonder if there is anything she could have put her body in and made it airtight?  So, no odor could escape.  Her dad was a cop and I am sure over the years he has had cases that involved death and what people have done to try and cover up.  Maybe they should look at some of Georges old cases.......Lets face it if Casey is just the run of the mill dumbass she would have made ALOT of sloppy mistakes.

 

Just some thoughts......

 

Debbie 

reply

Hi, good points...Gale's been by the house but I'm not sure if they were able to get anything.  30 days is a long time to think and react to any situation...how can we get these old cases of Georges?

Brian


9.6.2008

Hi Brian,
I just came across this.  It seems that at 2:45 a.m. this morning, The Anthony family got woke up !!!
They went to search Grandpa George's Vehicle !!!

Apparently, they took at least one item from the spare wheel compartment, in the back of his vehicle.
It is only on www.orlandosentinel.com right now.  The basic link will give you a still photo of them in the hatch and a paper bag with evidence.  There is no video of it yet on the site.
Click on above link for still photo.

Here is the link for the article:
"Investigator's remove evidence from car belonging to Casey Anthony's father"

http://www.orlandosentinel.com/orl-casey-anthony-090608,0,4836790.story

It would seem to me that LE knows exactly what they are doing.  Even though most everyone is totally disgusted, we need to have patience to make sure it is all done right, and NOBODY gets away with anything.  Sometimes patience is sure easier said than done though :) 

I would guess that maybe they got "themselves" a Lawyer at the right time ??
Casey hasn't even been home for 24 hours yet, and it seems like things might be starting to rock-and-roll ??
Blessings, thanks and safety to the Team and all the volunteers in Florida helping them.

Debra

P.S.  I think LE is getting REALLY SICK of this whole family !!!!   2:45 a.m. WOW !!!!! 

reply

Hi Debra, thanks for the update.

Brian


Hello Brian,

 

While watching the Friday September 5th edition of Great Van Sustren Great interviewed Leonard Padilla and during this interview Padilla talked about the first time that Casey was bailed out of jail and returned to the Anthony's home.  Padilla claims that the only time he spoke with Casey in her home she told him the now familiar story about how she gave Caylee to a woman name Zenaida Gonzalez.

 
 

During Padilla's conversation with Casey she claims that Zenaida Gonzalez and her older sister Samantha Gonzalez kidnapped Caylee and gave Casey a "script" that she was to read and act from for the next 30 days if she ever wanted to see Caylee alive again.  Casey also gave Padilla a description of the car that Zenaida and her sister Samantha drove which was a 2008 Silver Ford Focus.

 

Here's what we know to be fact:

 

1.  The police actually located a woman named Zenaida Gonzalez that looked at an apartment for rent at the Sawgrass apartment complex on June 17th. 

 

2.  There is indeed a Samantha Gonzalez that lives in Orlando, Florida about 23 miles from the Anthony's home.

 

3.  The woman the police interviewed named Zenaida Gonzalez who lives in Orlando, Florida does indeed own and drive a 2008 Silver Ford Focus.

 

Now I find all of these facts to be too much to be an coincidence.

 

A woman with the name Zenaida Gonzalez, the same make, model, color and year of the car, who looked at an apartment on June 17th at the Sawgrass apartment complex.

 

I think it's more than plausible that Casey's story in regards to what she told Padilla may be true.  How in the world could Casey come up with the woman's name, car make/model/year, and, tell people that Caylee was left with Zenaida at the Sawgrass apartments and have all of this be pot luck???  There has to be some truth in this.

 

Also, I know that the police interviewed the woman named Zenaida Gonzalez that looked at an apartment at the Sawgrass apartment complex but how do we know that this woman and possibly her sister are not really involved in this in some way?  The police may have made a mistake and eliminated her as an suspect and possibly have been duped and lied to by Zenaida Gonzalez.  It wouldn't be the first time something like this happened.

 

I feel that it is quite conceivable that Casey did indeed take Caylee to the Sawgrass apartments and met with a Zenaida Gonzalez who may have only been pretending to live there when in fact she did not only to take Caylee from Casey.  This could all be part of an elaborate child kidnapping ring whereby these people pose as babysitters and then take off with the child after they gain a person's trust over time.  It is possible that Casey had been taking Caylee to Zenaida at the Sawgrass apartments for several months and Zenaida was pretending to live at the Sawgrass apartments.  All she would need to do is wait outside in front of one of the apartments and act like she lived there and when Casey would come by to drop off Caylee it's possible that Casey simply handed Caylee to Zenaida without actually going into one of the apartments assuming that Zenaida lived there and when Casey left, Zenaida would be able to take Caylee anywhere she wanted to.

 

If all of the above is true and Casey was told to act a certain way or had been given "instructions" by kidnappers if she ever wanted to see Caylee alive again who among us would not do what the kidnappers told us to do in order to protect our child?  We live in a very screwed up world and there are alot of sick people out there and it's very possible that Caylee really has been abducted and that her abducters are playing a sick game with Casey.

 

Obviously this is just a theory and we simply do not have all of the pieces of the puzzle in order to fully comprehend the situation here.  I think that it's important for everyone to remember this because none of us really has all of the pieces of the puzzle so it's easy to make assumptions such as she's guilty or someone kidnapped Caylee etc...

 

The bottom line is that none of us knows why Casey is acting the way she is acting.  Is she acting this way to protect Caylee from a real threat or is she already dead?  Perhaps Casey did have something to do with Caylee's death whether it was an accident or intentional and if so the truth will ultimately reveal itself in time God willing.

 

May God help us to find Caylee alive and well and return her to where she belongs, with her family.

 

Peace.

 

Paul

reply

Thanks Paul,

Brian


At 2:45 a.m.

Investigators traveled to the Anthony home and removed evidence from a vehicle owned by Anthony's father, George Anthony. Deputies were seen removing the contents of the spare-wheel well and taking at least one item as evidence.

http://www.orlandosentinel.com/orl-casey-anthony-090608,0,4836790.story

 

A *************** said this is just the start of ''big news'' that is about to break!

reply

Hi, yes been up all night...it's about 6:30 am right now.

Brian


Brian, like most americans, I've become consumed by this very sad &
SICK case.  I read the posts on site daily, and have
been checking ID discovery regularly too, since coming across the link
on your site.
I don't know if you're aware, ID discovery's David Lohr flew out to
Florida to assist in the search with TES; he blogged today:  "The area
we searched was a dead end road near Moss Park. According to a
spokesperson with EquuSearch, the area was deemed important by the
Orange County Sherriff's Office. ..."

The link is: http://blogs.discovery.com/criminal_report/

Brian, I have to say to you, Gale and s team &
volunteers in the field:  BLESS YOUR HEARTS FOR THE WORK YOU ARE
DOING!!!  In ALL the cases you work on, not just for Caylee.

If I weren't in Montana, unemployeed & broke, I'd be there helping
them & contributing to their travel fund.  As is it, I'm praying
frequently for Caylee to 'come home';  she REALLY wants to be found &
is reaching out to anyone that can/will receive her.

Thanks for takin' the time...

With Love&Light to you all...
Sandra

reply

Well thank you Sandra, will forward this to the team.

Brian



Dear Brian,

When Casey was "living" with Tony when Caylee was "missing", she told him she had vacation time and was also able to work from home, so I am sure she had her laptop with her, just in case you did not get a confirmation on that.  (from doc's)

Also, it was stated by local media down there that her searches were "how to use it", for the chloroform.  There have yet to be any dates released as to when the searches were done to the multiple websites though. 

You have Rx in a DD, and you reference prescription drugs illegally with Casey a lot, if she could have gotten them in the last couple months.

A while ago I told you Xanax.  There is a very specific reason I "feel" this.  I "feel" quite sure Xanax was involved, and I know a lot of people said that afterwards, but I had felt that for a while, for a REAL reason.   I sent you an e-mail regarding Xanax, and uses, along with ways to use it.  There are a couple ways to get delivery into the body faster than swallowing a pill.  (I am not only referring to "snorting it", although some drug users do just that after crushing it.  Drug users will crush just about anything from pill to powder from Oxycontin to Ritalin, and everything else in between.)

Also, from the doc's, Lee called Tony, (according to his written statement given immediately), and Tony advised Lee that Casey had been telling him that she was seeing Caylee on a regular basis).  This would establish "quick knowledge" of "Caylee Missing", as far as Tony goes, as Lee started making calls right away to try to find out what was going on?!?!?  In Tony's statement to LE, he claimed that he did not know about it until morning when LE was at his door.  This is the lie I found.  I am sure investigators figured this out.  Tony seems a little "slick" to me.  I wouldn't completely trust him personally.

I know that none of this may actually help find Caylee, but wanted to let you know.

Thanks,

Debra

reply

Hi, she had the laptop with her most of the time, but many people had access to it...and thanks for the help.

Brian


I have not seen or heard  whether Cindy Anthony ever met Zenaida.You people are doing a terrific job God has given you all a gift and you are using it .Thank-you so much

reply

Hi, not that I know of.

Brian


Hi Brian,
 
All the news is reporting that at 2:45 in the morning the sherriff's dept went to Casey's house and took evidence out of Grandpa George's rear tire well. Don't know what it is. Was taken out in a brown paper bag. Can't find a news article on it yet bt as soon as I find it I will send it to you. Told you the family is in it up to their eyeballs. Unless Casey planted it when she was home the first time. Thanks for all that you do.
 
God speed to you and team,
Sue

reply

HI Sue, do you know if it was the right or left side of the vehicle?  Need to check something.

Brian


Hello Brian,

First, I would like to thank you and your team for all that you are doing.  I think you all are amazing!  I just wanted to tell you that while I was watching NG...(and honestly I can only take so much of that show then I have to turn it off...lol) but anyway...I did take note that the new Equusearch command center has moved and is now located at 6317 McCoy Rd., Orlando, FL 32822.  The 317 just POPPED out at me.  Maybe just a coincidence? ... I don't know.  Just thought I'd pass it on.

Thanks,
Angie

reply

Hi Angie...thanks...I see that Conway and Lake Warren are there too...I'm sure the area has been checked, but it might be a good idea to check it again.

Brian


Hi Brian,
I am sorry to keep bothering you with my thoughts. I sent you a weird dream I had the other day, I just sent you a little while ago a google map of a weird ray of light I caught while searching around the orlando airport.
But while reading other readers messages, I did a search on the psychic school web site and check out this map. With the detour the bridge and the yellow flower. I am just so anxious for somone to find this little girl I am brainstorming. But take a look at this map.
Please don't post my info, I am finished brainstorming, this case is driving me crazy.

Alicia

http://www.cassadaga.org/Flyers/Flyer2007/Flyer_BridgeDetour.htm

reply

Hi Alicia, thanks for sharing the dream...will share it with the team.

Brian


Hi Brian,

I keep checking all of the local media down there to get information on the search of George's vehicle, evidence, etc.  Besides what I have given you, there was only the brief mention on WFTV's site.  (which I gave you also)

I will keep watching and as soon as I can come up with more information or pic's, I will send them to you. 
I am also actively watching to make sure the Team is left alone.  :)  The media was crummy to them.  (I am being extremely POLITE :)

What makes me mad is that of seven local sources, all I am pretty much seeing is Casey, and her release from jail....the protesting that became a fight...the usual circus.

This is about the search efforts.  They are not leading with anything about TES, and the search for Caylee !!!

Caylee is the victim, not Casey, Cindy, George, and all the othe ones involved in this circus....i.e. Baez, NeJame, Padilla, Rob Dick, the bonding companies, etc. 
This is infuriating !!!!

News about a search warrant and evidence taken is important also. 

Will send what I find that is important.  I will keep looking for the search warrant to hit the major news sites, and hopefully get you some better pic's  :)

Thank you to you and the rest of the Team and volunteers. 

Debra

reply

Thanks very much, your work is appreciated...I was also told some of the police in the case are being offered movie contracts...not sure if its true or not though...if it is, this would only increase the amount of drama, and more than likely no more major develpments or arrests until Monday, primetime.

Brian


Hi Brian,
This just posted to WFTV Channel 9:
"Also, early Saturday morning, Orange County deputies removed a gun from a trunk of a car belonging to Casey's father, George Anthony.  Such a discovery on the Anthony property could have imperiled Casey Anthony's release from jail, but a spokesman for Orange County Corrections said that a judge ruled that Casey presumably had nothing to do with the weapon."
George knows better !!  It is part of her "home confinement" rules and regulations.
2:45 a.m. though?? and how did they know to go there for his gun??
:)
Debra

reply

Thanks...phone tip?

Brian


This photo was sent to you by: Debra

Here is one pic from vehicle search.  I do think it driver side, as I will send you another pic.  That is my guess based on angle.  The other pic makes it look more like driver side.

reply

Thanks again, wonder how long this gun was there?  Maybe the police knew about it, but got scared that with the protestors there, someone might get angry and use it.  Curious to listen to any 911 calls that night...homicide uses encryption correct? so this link would not be of much use.

Brian


reply

Hi, thanks, just found out.

Brian


I just read a blog that there’s a place called Sand Lake in Orlando, and Sand Lake’s advertises as “The Beautiful Life at Sand Lake.”  Casey’s tattoo says “Bella Vita” which means beautiful life, and I read that Sand Lake is close to where her car was abandoned.  Their logo also shows a bunch of flowers around a lake, and someone said Casey’s tattoo has flowers too (not sure if this is true).  Just wanted to pass this along… maybe there’s something to Sand Lake… 

Thanks for all you and your team is doing! 

Jill

reply

Thanks Jill, there could be.

Brian


Hi Brian,  Thought you’d be interested in these late breaking newspaper reports:

And my question I ask myself on this first one,

Is

Why does the law enforcement blindly believe Casey when she says she didn’t know about the gun?  Her butt should be sitting right back in jail, permanently.  What’s going on? This is starting to feel like a twilight zone episode.

Gun Taken From Anthony Home

Saturday, September 06, 2008 2:05:01 PM

Orlando-- News 13 has learned a gun was taken from the home of the grandparents of missing 3-year-old Caylee Anthony early Saturday morning.

The Orlando Sentinel reported Saturday Orange County deputies were seen taking something from the spare tire well in George Anthony's car.

A spokesman with the Orange County Corrections Department told News 13 they received a tip sometime between 12 a.m. and 1 a.m. Saturday of a handgun present on the Anthonys' property.

The weapon is being held by the Orange County Sheriff's Office for safe keeping.

Having a gun on the property is a violation of Casey Anthony's bail. Casey was released for the second time from the Orange County Jail Friday. The judge who issued the bail said, however, since it seemed Casey was unaware of the gun, she will not be taken back into custody.

And this:

 from:

http://www.missingabducted.com/2008/09/caylee-anthon-6.html

… the grandfather stated that he last saw Casey on June 24th, when she came to the house and he, wanting to get a "wedge" out of her car to change the wife's tires,  found the gas cans in the trunk of Casey's car that he'd reported stolen to the OCSO a couple days prior. …

(if it hasn’t been, why hasn’t this “wedge” been tested or talked about? …) 

Thanks for your time Brian,

A moment doesn’t go by I’m not praying for this baby.

Terry

reply

Hi Terry, actually I believe Casey about this one...so it was a tip...and they went right in the garage and found it?

Brian 


reply

Perfect!  Will print this out and hopefully will have something in the morning, if I do, I will send it to the team ASAP.

I think tomorrow is the last day they will be down there.

Brian

UPDATE: 9.9.2008...still nothing.


4:48 PM Audio update

Unfortunately, the team will be leaving Monday Morning, more details in the audio recording.

Brian


Brian,
 
Saw you on the chat last nite. Boy did you stir up things. Wanted to know who you were and what you was talking about. Need to stir up things again on site.
 
God speed,
Sue

reply

hi, what chat?



Brian

reply

http://cayleeanthony.chatango.com

It is on the forum there was this person on there that was saying to look under the bridge at moss park. It was typed in blue and had at the end Brian. I hope no one that is evil is monitering your site and try to mess it up on this investigation
 
Sue

reply

Hi, sorry I've never been there nor do I ever participate in any forums, or message boards...anywhere...nor have I ever.  I don't have enough time enough to respond to my own emails :)

Whoever this is...is not me...if they are saying they're me, then this is another issue, that I would have to act on.  If this is the case, please let me know.

Brian

reply

That is the case.

reply

Thanks for letting me know :)

Brian

reply

No problem I just don't want anyone missing this site up. Not fair to the people that really cares.

reply

It's happened in the past and I'm sure it will happen again...thanks again.

Brian

UPDATE: This has given me an idea, if anyone does with to chat with me, other readers or the TEAM can now do so by clicking here.

If we are on, we will be happy to chat with anyone that wishes to discuss the case.


Hi Brian,

 

Phone tip?

 

Do you honestly think that "lil ole me" would dial up Florida from Michigan to get information??????

 

In this situation I did NOT.  I stated that it just posted to WFTV Channel 9, but it was a paragraph in the middle of an article that is all about the protesting last night, that got very violent. I did not send the link, because you would have had to read through about the protest to find that one quoted paragraph I gave you.  I think we have had enough of that drama.  I am just glad no one was seriously injured.   I do think it is about time they pull the protest/fighting and Casey's release off the top headlines..........and put TES and Caylee...........and of course the weather information regarding Ike. Would love to have Gale and the Team and volunteers with her in headlines..........but we know how that would turn out, besides them being bothered while searching. I have dialed up Florida though, and also Tennessee !!!  (regarding this case)  (PR Firm is in Tennessee, I think) That press release from Baez's PR firm, is a disgrace.  It was unprofessional and had major grammatical errors, punctuations errors, etc. After I pointed out the above,  I told them that one of their paragraphs was completely incorrect.  The paragraph talked about how they would be handling media, since Baez (I will hold my tounge about him), would be concentrating on Casey's defense....or some such wording. (I did save the PDF, but didn't look it up to give you the exact words) I told them  that the entire paragraph was INCORRECT !!  I told them that the focus was CAYLEE, not Casey's defense.  I furthermore told them that the last time I checked, Caylee was a victim, not Casey. Since the man listed his name and phone number, why can't exercise my First Amendment??  I did not threaten, nor act nasty.  I made darn sure I got my point across though. I said quite a bit !! I know how to TCB.  I am used to handling major corporate operations and management, from years ago.  I didn't use much "sugar" on this one though. :) Debra 

reply

Ok, thanks Debra...personally I do not think any protests should be allowed in front of the home.

Brian


Brian,
 
It was the left side was just on channel 13 news. It was a gun. That was a violation of her bond but Judge says since she was unaware of this she will not go back to jail. Please go to channal 13 news on the web to get the story. I can't e-mail that cause I don't have that type of mail set up. No other channel is got the story on the web.
 
God speed,

Sue

reply

Thanks Sue...Brian


Hi Brian, 

George has had the gun on the premises all along.  I remember when a reporter was asking Padilla about if his Security was armed, and how that worked with the rules of  "home confinement".  The armed security could be OUTSIDE the structure.  No house.....no garage.  He was asked if George had a gun also, and he said something to the effect that "George would take care of it". (I don't know exactly what CCW laws are in Florida, but here you need a permit.  With that location in his vehicle, he had it concealed.  They pulled back the carpet !!) 

Did you watch George Freak Out????  He was hitting a meltdown.  It was the afternoon of the Friday that Casey got re-arrested.  If you didn't take the time to watch it, this will show you exactly why George should NEVER have access to a firearm/weapon of  ANY kind.

http://www.wftv.com/video/17337816/index.html

In case you didn't watch it, Cindy with a HAMMER that same morning.  (Keep all sharp objects/weapons away from her too)

http://www.wftv.com/video/17334271/index.html

Things will only escalate again now that Casey is home.

 ***VERY IMPORTANT***

All of the media and private citizens in America are putting Caylee in a coffin.  Cindy claimed this on the Today show, I think, not taking the time to verify.  If we don't all believe she is 100% alive and find her something will happen to her.  This was  a few days ago, so it is setting the stage for "the kidnapers did it".   ***Don't forget Brian, you, I and everyone else  are "putting her in a coffin". 

I don't think the protesters will stop showing up.  The community is outraged.  I have mixed feelings about it.  I personally wouldn't do it, just like I won't sit in front of the 24 hour webcam.  I do think they need to be more controlled.  I am all for ANY additional pressure they face sitting inside their house, while others are out looking for the remains of their granddaughter !!!!  

reply

Hi, I agree...but I have now found myself staring at this webcam...not sure why...but I am.

Brian

reply

Since you seem to be "easily amused" now also (LOL), here is the aerial cam link from foxorlando.com.

http://media.myfoxorlando.com/live/truck20mobilecam.html

It is partially working. 

Sometimes it doesn't work at all.

Have fun !! :)

Debra

reply

oh thanks...now I'm never going to get any work done :)

Brian


OK...that's enough of this...back to what's really important...that's why I have a critics page.


9.7.2008

Hi Brian,

TES is suspending their search for the reason of "environmental conditions and concerns".  No further information than that though.  Just announced this afternoon.  Here is the link:

http://www.wftv.com/news/17393803/detail.html

"Search For Caylee Suspended"

Thanks,

Debra

reply

Sorry to hear this, just read the article...since it's not a hurricane, I can't see how search conditions are going to improve and time soon...do you know if they're heading back home?

Brian


Closing Comments:  The Team is leaving for Ohio tomorrow morning, and I'm sorry to say, they were unable to help find Caylee...the team is out of funds and must be out of the hotel in the morning.  We would like to thank everyone that helped us during the past month, without you, the team would have never been able to make to and from Ohio...twice!  I know it's more than a 20 hour drive back, so Gale please drive safe :)

Texas EquuSearch: I can overlook issues like inappropriate/degrading comments about myself, Gale the team and the dogs...I can look the otherway regarding statements made by Tim Miller as to how, why and when TES came to Florida...but what I cannot ignore is the total lack of corporation when it comes to freely sharing of important search information.  Everyones knows the team was there three weeks before TES arrived...the team worked from sunup to sundown every singe day searching large areas of land.  When TES did arrive, we supplied them with maps of the areas the team had already searched and areas that we planned on searching.   We were hoping they would do they same for us...but no...not only did they laugh at the teams efforts...they completely ignored what we had done, and refused to tell us the areas that TES and their volunteers had already searched.

My sites readers have also donated a significant amount of money to TES using my sites payment to charity option, mailing list and radio show...in fact, I believe we raised more money for TES that we did for our own project...which at last word, is about $300 short in getting them home.  For this reason Gale is driving straight home tomorrow with no hotel stops.

One more thing about donations...Gale and the team were never paid a dime for the three plus weeks while there where down in Florida, this non-profit account does not pay salaries, only expenses. They took three weeks off from their jobs too do this...so did Wyatt and many other searches.  Gale has put more than 6,000 miles on her minivan so far, and has another 1,000 mile drive home tomorrow.  I consider myself lazy compared to the work these guys have done.

The Media:  I cannot tell you how to do your job, but the more you make your true intentions known, the more people will stop watching...you're suppose to be covering a missing person case, and using the power of the media to help bring her and so many others home...yet most coverage has turned into a made for TV Docudrama, which I'm starting to believe now involves members of the police themselves...I'll be watching tomorrow to see if this is the case.  I consider myself lazy compared to the work these guys have done.

Orange County Sheriffs Office:  We never expected help or cooperation from them, and this is completely understandable.  But we did not expect to be setup for failure, laughed at and have our dog team discredited...all the team wanted to do was help, and their efforts were completely ignored.  And speaking directly to the homicide division...I ask that you set your Tivo's to record the re-airing of this program on the Biography Channel...watch how it it ends.  It's just one of the many cases other police homicide departments have worked with Gale and gained positive results that saved lives.

These are my own comments, and I do not speak for anyone else.

Brian

PS...Wyatt will be continuing the search after the team leaves, we're in the process of setting up a non-profit search and recovery organization based in Florida that will be more opened minded in the future.


I know you’re busy and have limited time, and sorry to be such a pain, but I strongly feel you need to check out the Hummingbird Lane and Boggy Creek Road areas before Gale leaves town. It would be good to search on Sunday because the will be no one working the construction site so it is less likely you will be chased out. Also, if you park at Austin Tindall Park and walk the street to the retention pond ... it may not be as noticeable! This area has almost all of the clues/details of what you, Gale and Travis brought through and which Caylee has shown to Maria. We had no idea about your website until after Maria received this information and we all were happy to see so many clues/details in common.

 

This is what Maria described during the Cross Over session when Caylee came through:

 

Who is Kay, Kay-Lee or maybe Karen, I have a K sounding name like Caylee? I have a child here, a girl, with shoulder length, light brown hair, wearing a yellow t-shirt, white shorts and pink shoes ... no ... only one shoe. She has bruises all over her body. She is by water ... not in the water. She is holding up her fingers indicating the number 3. It could be her age but the number 3 is very important to her.

 

Maria heard/saw Caylee singing “Itsy Bitsy Spider” as well as saw her being put into the trunk of a car. She has seen the two people in the car(Casey and a young man) as well as other very important and pertinent details. She also has had subsequent visits/visions/information from Caylee. Maria sees a green highway sign with the letters “N – A – C” near the Orlando Airport (Narcoosee Road). She also had a vision of a dirt or unpaved road, with water to her left and a large field to her right with a row of trees across the field. It is not too close to any residential complexes. There are planes going constantly overhead. Caylee is near the water but not in the water. (Perfect match to Hummingbird Lane & Boggy Creek retention pond). Also with the information from your team about a “closed road and construction” it is right there next to this area as Gale said on the radio interview!

 

Also black & white sign with orange – see the pics – black and white permit sign (check permit numbers for 317 or the 217736 number?) with orange cones. Wildcats – two construction equipment vehicles (CAT). Concrete block (with A & #3). Gale says she is next to the pole. See the blue water pipe. To the left of the pipe is a depression in the grass (picture with larger circle) with wild flowers marking spot (see smaller circle inside larger circle).

 

There were also some yellow flowers in this meadow area. It is near a park (Austin Tindall Park). Seminal = Semoran Farm Road? Marshy/mushy area due to all the rains. Bathroom or maintenance area? ... possibly the port-a-john?

 

Just as Beverly said, we believe the body/remains have been moved or washed into different areas. (Itsy Bitsy Spider). Because the body would have decomposed by now and only clothing or bones remain, Caylee may not be in just one spot of this area, sad to say. Please try to check this out or share this information with the proper authorities and TES if you can’t check it out personally.

 

Keep up the good work, and I realize it is a very tough job but it is so hard to sit back and wait for verification. Especially because Caylee is hanging around trying to get us to find her. Maria and I don't feel we are wrong about this but if we are, it would help to bring some closure to us if its been checked out and disproven.

 

Thanks and take care. Gale & team members, be safe and have a safe trip home


Karen

 

reply

 

Hi Karen, will make sure the team gets this asap.

 

Brian

 

 


Turns out it’s a Lindsey Lohan song that Casey likes.

“Everyone lies, everyone dies” is part of a lyric to another one of Casey’s pop favorites.

So, Bella Vista might have no significance to Caylee’s gravesite, at all.

 

reply

 

Hi, I think you're right.

 

Brian


 


I know last week I was looking through your dreams, now I can't find the one I found, but it had something about Neptune and I think it said buried sand not ashes, anyway, in Kissimmee, Fl. there is a road named Neptune, was wondering if, Casey had told her dad where she buried Caylee, and he then moved her to another location. Wonder if the police are following him ,Cindy, and Lee since this all started, anyone of them could've returned to the scene, not just Casey?Thanks, I hope they find her soon, and get this drama over with.

 

reply

 

Thanks, know the dd and it might not be related to this case...and me too.

 

Brian

 


Brian,

I applaud all the work your team does. Gayle and the people who take the
time to search in such a challenging and exhausting environment, are
just plain angels.

I do not like to gossip or give bad information, but I saw an
interesting post on one of the message boards that talked about an area
I do not believe you or Gayle had mentioned on your site yet. I hope
that if this place has not been checked, that either Gayle's team could
do so before they leave or they can pass the info onto other searchers.

God bless you all and God bless Caylee.

Tina

Here is the exact post copied and pasted:

kwb510 wrote:

 

This might sound like it's outta left field. A week or so after Caylee
was reported missing there was a teenage boy on the local news stating
he had found a backpack and little girls shirt, if I remember correctly.
The news said the items were found on land backing up to Chapel Hill
Cemetery. The cemetery isn't all that far from 50 and Goldenrod.
I have visited the cemetery numerous times over the last 30 years and I
can't remember anyone ever being there at the same time I was, with the
exception of a few employees. The only security I remember them having
is a gate they shut at closing time. It seems like it isn't fenced in,
although I could be wrong about that.
What has crossed my mind is that if Casey had help, how hard would it
have been to bury Caylee in a recently dug grave. Move the flowers, dig
down a little ways, replace dirt and flowers. If there is no fence it
could be done at night with a flashlight. It's a fairly good sized
cemetery and no one would have even noticed. Sure would be an unexpected
place to hide Caylee and a darn good one. Who would look in a cemetery?!
What I'm also wondering was anyone buried around the time they think
Caylee was taken from the backyard.

reply

 

Thanks Tina, will also post this information...I'm not sure.

 

Brian


Sue has sent you a link: "Search For Caylee Suspended - News Story - WFTV Orlando"

The link:

 

http://www.wftv.com/news/17393803/detail.html?taf=orlc

Message from Sue:  even the team is leaving I will send news to you all. God bless all of you and thanks for the chat site. I think it is helping alot of people get some frustration out

 

reply

 

Welcome Sue, and glad its working...I was unable to get on :)

 

Brian

 


**** REMOVED PER REQUEST ****


9.8.2008

 

hi brian..I did some investigating into amy..and she still has casey as her friend on facebook and my space..i find this weird..since she has agreed to charge amy with stealing her money.Most people would remove someone like this..I think i am right for them to be still friends amy knows something more then what she has said to anyone. Someone should interview her..and try to get her to admit what she know..s..i think she could be a big help in this case..glory..
P.s..I was wondering if you looked at my other four emails yet??? Including pics of wildcats shirt..thanks..
=

reply

 

I agree, no but doing that right now.

 

Brian

 


Hi brian..i had sent you a note..telling you about my dream from before caylee case hit the news...and the one since..anyway..alot of what i dreamed..is in your pages..found amy..last night to be her friend..who she stole money from..In my dream a girl named .amy knew stuff..i think she knows something that she doesnt realise is important..or she knows more then she is saying...Anyway..your one drawing...says wildcats tshirt..I was looking at your site..wondering if i just had the dream..coincidental or wether it meant anything..I thought  this is crazy..ive had stuff come true..but never emailed..or got involved with anything..as i was wondering that..i see wildcats..tshirt..im enclosing a pic of me..with a wildcats shirt on squating down with  my granddaughter..it was taken about two months ago..It was like asign..that what i am dreaming is about this case.I had just said i wish i knew or had a sign then i see that tshirt note..im not sure why you had it written down..but maybe some of what ive said to you is important..glory..    
P>s..the other picture is me in the same shirt with my son..josh.I could go into a list of things i have had happen that came true..and send you pics of me..from a baby to now..with lights all around me..usually when something is going on..I beleive seeing that letter of yours..was a sign to me..that i am getting info on the case..and i hope you look at my three previous emails..also the fact you wrote about a friend on that one..when i see amy as knowing something..and i sent that to you yesterday before seeing this paper you wrote.If you cant find my emails with the info i have had ..come to me..i will resend it.Usually when things come true for me..its not exactly how i dream or see it..but later it all makes since..Please look at the things i have wrote and see if any of them can be put towards this case..It seems weird that most of the names are streets or lakes in florida /orlando area and i had the first dream before this hit the news..my daughter can tell you that .She is in university going through for a psychology professor and very truthful.My kids have witnessed me saying things that have happened..Please write me back this time..and let me know what you think..thank you..glory


1:25 am...Gale called the sheriff's office to ask if they were going to arrest her...they are sending a car back out...will keep you updated here.

Brian



Brian..
Avenue c..32827..google numbers to 5th street 32827..Now 5th street ends and is blocked off.yu want..the part of it that crosses avenue c..and then goes towards airport property..and ends in a circle..look at the street view..its like standing there and being able to look around..at the ground.bush,grass everything..just click on buttons to move up and down the road..on google map..i have feeling about this area....right next to airport property....Please have someone look in this area....thanks glory..p.s..its hard to get up on google..you might have to go to barnacle road then go street view..and go up to avenue c..then to 5th street..you will know when your in right spot..because its a long private road..has building across from road..white..maybe maintance..and it ends in a circle..if you get on 5th but it doesn end..then your on the wrong part..or on wrong 5th street..almost easier to find if you look at bigger map..look at left side of airport..see c avenue..and 5th street is only street running into airport property..then dead end..thanks glory... 

reply

Hi, will send this to Wyatt.

Brian


Gale and the team are on the way back home, she says everything is just fine for the team...as for Debra, she's trying to explain why she filed charges that Gale stole her credit card.

Brian


UPDATE:  Wyatt will be running the search down there now, and he is able to check areas upon request.  Please keep the emails coming in regards to locating Caylee, but please no more regarding last nite's events


2:26 PM - Ok to post - did the golf cart get fixed?

Hey Brian,

I wanted to send you a list of the names of those who dedicated their time to the search for Caylee here in Orlando.  I want to thank them all for their selfless acts, their time, their donations of water, and supplies, and above all their compassion for wanting to bring little Caylee home.

I would also like to take the time to thank the following organizations for assisting us:

Keiser University Forensics Class  (Instructor Blackmon)

Thank you again to all who helped Gale and her team, and thank you from me for coming out.

Wyatt Locke

Search Coordinator

wyatt@


Hi,

I just got off the phone tonight with a psychic friend tonight about Caylee. I do have some clairvoyant abilities as well. He seems to think Caylee was smothered with chloroform when she wouldn’t stop crying—it was an accident, but she was crying because of her mom’s friend that she was scared of. As the case developed, there was a Deputy that was fired for having a sexual relationship with the mother and lied about it. From the very get-go, I can’t shake this gut feeling I have that he had something to do with it—that he, as a deputy, would know where to deposit a dead body and as a lover to her (Casey) would do this as a favor. My friend agreed that he might be the one involved, and when I described his physical attributes to my friend he said it matched. There might be something there. He was the “Tony” she kept asking for in the tapes.

I keep thinking Caylee is near the airport—Around Lee Vista and Econ Trail and near a pond—but not in water. I think with all the rain TS Faye dumped, her body may have been submerged for a while from the flooding in the area or she’s in a flood-prone area. Also, the Dean Rd area comes to my mind—Blanchard Park, among others, as well as near the 417 exit for the airport. My friend thinks it’s in a wooded area, and there is a branch that marks her spot. ??? Does this help? 

Sincerely, 

Kim

reply

Hi Kim, not to me but will post this.

Brian


Hi Brian,

 

Sorry to hear about Gale's troubles.  I can see this is affecting you deeply too.  I'm sure it will all come out ok, with God's help.  There are just too many paper, and even audio, trails for it not to come out right.  I'm very sorry the team is going through this on a personal level and also sorry that it's distracting everyone's time and focus from better things.

 

I ran across this link to a map with what is purported to be search sites marked, along with other landmarks of interest:

 

http://maps.google.com/maps/ms?hl=en&gl=us&ie=UTF8&oe=UTF8&msa=0&msid=112207365672542480712.000455b4884de4fdc7516

reply

Thanks, very useful information.

Brian


**** REMOVED PER REQUEST ****


I really want you to look at my search suggestion as I feel so strongly about it.  I also noticed that a recent entry also mentioned Avenue C and 5th street which is EXACTLY where I was looking at last night on the Google map.  That 5th street, off of Avenue C dead ends!  and there is a hump of land right there, just like your dream.  I just think if you and your researchers/searchers would look at what I am trying to show you, you might get an impression of little Cayley Anthony.  I know this area  so well and anyone who lived here would know that this area is practically deserted.  There is a big open field right next to this 5th street with a drainage canal and right across from this big open field is a thick stand of trees, just like that other entry was talking about.  I sure wish Gale and Dogs were still down here, but maybe someone else can check this.  If you need any other info, please contact me.

 

Brian, I sent this 2 days ago and I was not sure I sent it to the right address. I feel strongly that Gale and the team need to check this area out before they leave.  It fits so MANY of your dreams and entries of others.  Thank you for your time and all that you and your team are trying to do!  Karla M.


Brian:
 
I have been reading note from your web page.  I thought you might find this of importance.  Myself and a friend searched an area(7400 Narcoossee rd.) on Sunday 7, 2008 at around 10am. The drive from Caylee's grandparent's house to this locate is 2.8 miles.  If you were to walk back into the wooded are of interest it would make it close if not exactly 3.1 miles.  On our search we came a crossed some interesting items. The flowers, weed like but pretty. White daisy, goldenrods, and purplish red flowers that have a look of baby oricds.  This area is a park like. I also noted a cement slab in the woods, at first glance we thought it was sand . I think it was because the sun reflected of the concrete. This area is very remote once you drive off the main road no would see you. There is also a open field there. In this field there was an abandon city truck from Lake Mary, which is located in Seminal County. The tick infested field is accessible by car. The ground was still very wet so we were unable to go by the pond, well that and fear of alligators and we lacked the man power. This area is located next to a cement factory and some other metal type building. Both buildings have tall cylinders three on the left building and two on the right building. We also located empty bottles of cleaning products, buckets, and a child's green wagon.  We started our search after saw Gale on the news.  We  did a blind drive and came a crossed this area.  Although I read your entries , the location was chosen by feeling. Although, we were unsuccessful I still feel this is were we should focus.  If you want to discuss my finding please call me at ********* ( do not disclose number on web). I have also attached a few area maps and where we found some of the items. I thought maybe talking with someone might confirm there visions or feelings.
 
Kari
 
Hi, looking at the maps right now.
 
Brian

 

 


Hi Brian,

In case no one has mentioned this to you, it seems that the distance from the Amscot Check Cashing place to Jay Blanchard Park (which Casey has mentioned on several occasions and has now stated in her NEW story that this is where she left Caylee with a bunch of people and the ever present Zenaida) is approximately 3.2 miles--I would say that is quite close to 3.17 (the elusive 3.17), and am curious to know if Google Maps rounds up or down to the nearest tenth of a mile and in actuality the exact distance is 3.17 miles between the two?  Here are the addresses so you can see for yourself:

 

7501 E Colonial Drive, Orlando FL (AMSCOT)

2451 N Dean Road, Orlando, FL (Jay Blanchard Park)

 

If this is the case, I would say that perhaps Casey's new story is designed so that law enforcement will go back to Jay Blanchard and find Caylee so she can be put to rest, but the blame still rests on someone other than Casey, IE the group of people and Zenaida.  Casey can say that she last saw Caylee alive with the group of people, and that they must be the ones responsible for her death and disappeared after the incident at the park.  I know this park is where the clothing and backpacks were found, but the search by the water was cut short due to the conditions, I believe?I have a feeling she may be trying to say that Caylee will be found here. 

 

What do you think??

 

Haven't spoken with you in a while, I hope all is well.  I am about to have my second child in the next few weeks--haven't been emailing as much but certainly been following the site. 

 

Take Care,

 

Tara

 

PS: Cases with huge publicity such as this one bring out the bottomfeeders and those seeking more than just missing children and justice--they want the fame and recognition.  Anyone who is a true briansprediction.com follower knows what your intentions and those of your close friends (GALE and the team) are.  Jealousy is ugly and shows itself big time in situations such as this, which really once again takes the focus off of what this should be about--CAYLEE CAYLEE CAYLEE!!! 

reply

Hi Tara, not sure yet.

Brian


Does anyone know if police if a can of acetone was found in the Anthony home?

Brian


This is updated Google map.

http://maps.google.com/maps/ms?ie=UTF8&hl=en&msa=0&msid=112207365672542480712.000455b4884de4fdc7516&z=10


brian,

is this not some of the streets that you and some of the others have been talking about ? does this not ring a bell ???

love your work, right behind you.........

janie

Four people have been charged with kidnapping after threatening to kill a woman if her mother did not pay a ransom.

An Orange County mother received a call Sunday night from her 20-year-old daughter claiming she had been kidnapped. A man told the woman she needed to meet him with $2,600 or he would kill her daughter.

The kidnappers told the mother on the phone that her daughter's boyfriend owed them the $2,600. They told the mother to meet them at the Blockbuster at the intersection of Chickasaw and Curry Ford Road with the money.

The victim’s mother contacted the sheriff’s department and deputies were able to pick up the suspect’s vehicle.

"Deputies responded. They were able to pick up the suspect vehicle. Good intel basically. We knew what we were looking for. They showed up at the appointed time, the appointed place," Jim Solomon of the Orange County Sheriff’s Office said.

Deputies were able to arrest four people without any injuries.

Oscar Maldonaldo, Ruben Torres, Wanda Rojas and Carlos Mercado Rodriguez were arrested and charged with extortion, false imprisonment and possession of a concealed weapon.



9.9.2008

Arcadia Acres Park??


Thank you NG for the LOST sidebar.

Brian


3:13 PM

The server went down and I'm restoring it right now, should be fully up in about 5 hours.  If you visit a page of the site that's not been restored, you will get a 404 message stating the page is missing, or membership is required to view.  If you get this page, come back in about 5 hours, it should be uploaded by then.  I had 2.1 gigs of data deleted, and using a dsl connection this is the reason why it's taking so long to restore.  I did have a dial up connection, thank God I paid the dsl bill :)

Brian


Gale,

Renea and I are going out tomorrow at 9 - she is a great help since she knows all the old "hang outs" around the area.  She says the B-52 park is a well known teenage place to park.

 

Just got a tip from someone who mentioned the lake Warren area, behind Pay Lass Car Rental on McCoy. She says that Casey was going to park her car there and rent a car, but didn't have the money. She mentioned the canal that is accesable from the back parking lot of PayLess. However, for some reason I don't think she means the BIG canal where "Mr. Nasty" was swimming.  I remember a small canal to the side of PayLess.  It was overgrown, but definately had water.

 

I'm willing to go back and poke around that small canal if you think it's a "warm spot".  It IS accessable from that back lot.  I find it sort of weird that this person actually knows this since it's not really evident on the aerial.

 

If you can, let me know if you think it's worth another meeting with "Mr. Nasty".  I'll just beat him in to submission with my stick!!!

 

Cindy


Hi Gale!

 

Just want you and the team to know how much you are loved and appreciated. As I told you on the phone I plan on going out tomorrow with Renea.  We'll try to find the sppot by the airport you mentioned and also try to get out to Bithlo and scout out the Hollister area. If there are any new areas or streets that you can forward to me, please do and we'll check them out ASAP.

 

Love Cindy


Sue has sent you a link: "Casey Anthony Offered More Than $1M To Tell Story - Orlando News Story - WESH Orlando"

The link:
http://www.wesh.com/news/17432283/detail.html?treets=orl&taf=orl

Message from Sue:  trying to make money off of this tradgy

reply

If telling us where Caylee is in the deal, it might be a good idea.

Brian


Porn site:  Seems there is still a rumor that run a porn site...and now I was told that I just sold it for $20,000.   To set the record straight, I do not run a porn site, and did not sell a site.  The last domain I sold was over a month ago, and it was for $300.  Actually I think it's very interesting how things get said, and what the media picks up on...all without investigating if it's the truth or not.  If I did run a porn site, and someone asked me...I would say yes...enough said, and I'm sorry, but I just had to bring that up.

Brian


Brian,

 

I was just watching the news clip of the woman who was going trough the Anthony's trash...I read that there was a hat, possibly Casey's...with Shamrocks on it...plus didn't she have a shamrock on the window of her car?  Could that be the 317 ( St. Patrick's Day ) that you are thinking?

 

Just a thought...please reply...please

 

Carrie

reply

Hi, sorry for the delay Carrie...do you have a link to this report?

Brian


Sue has sent you a link: "Bodyguard: Casey Said Toddler Left At Park - Orlando News Story - WESH Orlando"

The link:

http://www.wesh.com/news/17426676/detail.html?treets=orl&taf=orl

Message from Sue:  I think these people are full of it

reply

Hi, worth checking out...I think we now know someone who really understands Casey's


9.10.2008:  The server should be fully restored now and I think I've fixed the page scroll problem...let's hope this does not happen again...very time consuming :

Brian


Hi Brian…

Here is the original locations of Caylee from the dreams I have had…  She started off at pin 2… and when the water rose after Faye… she ended up floating down to pin 3.

The hand marks  the original place Caylee was laying…

In my dream she floated under these two bridges…

And ended up resting on the NORTH bank in that arched indention.

Here is the end location zoomed out…

Please pass this to Wyatt.  If he were to walk from the beginning spot up to the end spot… he will find evidence.  The final resting spot is a little over a mile from the original location. 

Anyway… I had originally gave this information to ******* … but… I was not sure if she had ever passed it along to you or Gale… and since Wyatt is still searching… I thought I should pass it along to you again.  

Also attached is the original messages I sent to ******* … 

Beverly

 These are Google Maps of the location that I feel Caylee was and where the water during and after the storm pushed her.  As you can see… she was carried quite a way.  She went from the south side bank of the canal to the north side bank landing in a sandy area.  From the grassy, swampy, yellow flowers patch to a rough, sandy, area near a bridge. 

OK… I think I’ve done all that I can now.  If I happen to feel anything else I will contact you again.

Please confirm that you have received these emails so I do not feel this strong urge to resend these.  I don’t want to wear you out… I’m sure you are quite busy without my input.

Thanks… 

Beverly

From:

I stumbled across a site about Brian’s Dreams… very interesting site… Brian sounds like a really neat guy.  Anyway… I have had the little Florida girl, Caylee Anthony, on my mind since before her disappearance was reported.  Such a tragic set of circumstances… poor baby.  I have this very urgent tugging today… I woke up this morning feeling this anxious, “I have tell someone” feeling and I didn’t know who to say anything to because it is strange at best. 

I am a published author… http://publishedauthors.net/beverlyhutchinsonterry  is my website… my book and bio should give you enough insight into me to get my “feel”.

Anyway… the pressing issue is Caylee…  the storm that went through the Orlando area (and most of the rest of Florida) raised the water level in the area where Caylee’s body was tossed.  The independent searchers almost found Caylee… Caylee was tossed down a slope where Casey spilled out her purse… and landed almost in the water in a marshy area of tall grasses (kind of prickly looking like ferns) and yellow flowers.  Near a soccer field.  When the water level rose yesterday and last night, Caylee’s body was dislodged from the grasses and flowers and floated up to the top… then… was carried along with the current and is now resting along the bank quite a way from the original spot of grass and yellow flowers.  Please search that area again… where the grass and yellow flowers meet the water… just below the slope where Casey’s make-up and purse contents were found.  Find that spot… then walk along the bank in the direction the current flows… you will feel as if you have gone too far… but… keep going another 100 yards from the point you feel you have gone too far and look down at the edge of the water.  You will find her there after the water recedes again. 

My first connection to Caylee unexpected happened on the night of June 16th in my sleep… I woke up the morning of June 17th and kept thinking “Kay Kay”?  “Kay Kay” is so confused.  I had a tugging that a little girl called “Kay Kay” was frightened and confused… trapped in a dark narrow place… that smelled of exhaust… a car trunk probably.  She was scared and crying, but so hot and sweaty.  Then, a “Mommy” with shoulder length brown hair that smelled of alcohol opened the trunk and shook the girl.  The girl did not move… she placed her hand on her little chest… and did not rise… she put her head on her chest… there was no heartbeat… “Mommy” then slammed the trunk closed.  

The night of June 17th was another night of tossing and turning… Then again on the night of June 18th, 19th, and 20th.  I woke up the morning of June 21th and kept thinking “Kay Kay” is so cold and wet.  I felt her laying there in a wet, prickly place… I floated above with her and saw the water and grass and yellow flowers and the only thing visible of “Kay Kay” was her little shoes floating up at the edge of the water.  She was laying with her feet in the water and the rest of her body was covered by wet grass and  yellow flowers.  There was a mess on the ground… make-up… a cell phone… a pink blanket.  I felt “Kay Kay” questioning, “Where is Mommy?  Why did she leave me here?”

The night of June 22th I dreamed of the little girl again… her feet now sinking… her shoes waterlogged and heavy.  June 20th I dreamed of abandonment.  During the days of June 23st-July 3rd I felt a feeling of “all alone”.  I knew something terrible happened to a young girl because her Mom had left her in the car all night long.  Then… the mom left her in the trunk of the car, dead, for 5 days until she tossed her down the hill on June 21st.  July 4th… there was no longer a connection… I didn’t feel her any more. 

I pushed the feelings those couple of weeks away… didn’t know who to tell… I didn’t know the names… just “Kay Kay” and “Mommy”.  I didn’t really know the location except somewhere kind of tropical and hot.  So… that would just not make any sense to many people.  But then… the story broke on July 15th… I heard about it on July 17th when someone at work was talking about it… and I felt so sad and sick.  Since no one has found her little body, I now feel the strong urge to tell someone about where she is…

Please go to the soccer field… to the edge of the slope where the purse was dumped… you will find one of her shoes at the edge of the water hung up under a large stick… walk along the water’s edge the direction the current flows… keep walking until you feel as if you have gone too far… and continue walking 100 yards from that point… look down… you will see her hair floating at the edge of the water… she is there waiting to be found.  You must wait until the water again recedes from the storm… but… she is there and floated there during the night last night.  August 19th

Hopefully this will bring Caylee home so the grandparents can rest again.

Beverly

reply

Thanks so much, I hope it does too...will post these maps right away.

Brian

 


BLANCHARD PARK - CAYLEE ANTHONY

ORLANDO -- A University of Central Florida graduate student was found dead one day after she was missing while jogging.

The remains of Nicole Ganguzza, 26, were found Wednesday night in the woods near Econlockhatchee Trail and State Road 50.

http://www.cfnews13.com/News/Local/2...ng_jogger.html

reply

Hi, sorry to hear this, the link is not working.

Brian

 


Hi Brian,  

The news story about the neighbor, goin through the Anthony trash, showed a baseball cap that looked like one Casey wore. It had a shamrock on it, and it looked like it had a section on the left side near the back cut out, interesting. Have you done or considered doing a remote viewing on Casey? Maybe you could see what she did with the Caylee in June.

Diane

 

reply

 

Hi Diane...all I can do is try.

 

Brian


 

**** REMOVED PER REQUEST ****

 


How did you know about the bug in the Anthony's home?

 

Jen

 

reply

 

Hi Jen, did he find the bug?  Just looked in the news and it did not say that.

 

Brian

 


I am writing because something jumped out at me today. The child's green wagon the searchers found. (from the posting I copied below)  There is a picture in this thread of Casey pulling Caylee in a little green wagon. It probably doesn't mean a thing but maybe you could contact the searcher and find out more about the wagon. If it was plastic, metal, colored wheels etc.?

You don't need to post this, I just thought I would pass along this info.

Thanks for all that you do - Melissa

 

Brian:
 
I have been reading note from your web page.  I thought you might find this of importance.  Myself and a friend searched an area(7400 Narcoossee rd.) on Sunday 7, 2008 at around 10am. The drive from Caylee's grandparent's house to this locate is 2.8 miles.  If you were to walk back into the wooded are of interest it would make it close if not exactly 3.1 miles.  On our search we came a crossed some interesting items. The flowers, weed like but pretty. White daisy, goldenrods, and purplish red flowers that have a look of baby oricds.  This area is a park like. I also noted a cement slab in the woods, at first glance we thought it was sand . I think it was because the sun reflected of the concrete. This area is very remote once you drive off the main road no would see you. There is also a open field there. In this field there was an abandon city truck from Lake Mary, which is located in Seminal County. The tick infested field is accessible by car. The ground was still very wet so we were unable to go by the pond, well that and fear of alligators and we lacked the man power. This area is located next to a cement factory and some other metal type building. Both buildings have tall cylinders three on the left building and two on the right building. We also located empty bottles of cleaning products, buckets, and a child's green wagon.  We started our search after saw Gale on the news.  We  did a blind drive and came a crossed this area.  Although I read your entries , the location was chosen by feeling. Although, we were unsuccessful I still feel this is were we should focus.  If you want to discuss my finding please call me at ********* ( do not disclose number on web). I have also attached a few area maps and where we found some of the items. I thought maybe talking with someone might confirm there visions or feelings.


reply

 

Hi, thanks it could be important...so I'm going to post it.  Also, your # and the pics did not come through.

 

Bran


9.10.2008

 

Good news

Just spoke with Wyatt. There will be a search continuing this weekend! Not sure on how many, but there should be  decent amount. Please  post this and also let them know how to contact him if they'd like to join this weekend. Once again, thanks to Wyatt and the continued support of the community for joining the search for Caylee.

Gale

 

reply

 

Wonderful news...will do.

 

If anyone wishes to help search this weekend, please give Wyatt Locke a call at

wyatt@

Brian


 

CHAPEL HILL CEMETERY

 

area 1

 

Please look under anything that can be easily be removed or pried/lifted open with a shovel...pay attention to that seems out of place.

 

wood piles, equipment, broken down vehicles etc.

 

 

area 2

 

 

area 3

 

 

area 4

 

 

 


Brian,

I was reading on your site today and saw the woman's post regarding the connection between the cap Casey threw away and 317, or the date 3/17.

 

Attached are two pics of the shamrock tattoo on Casey's back.  In the closeup pic of the tattoo the top part of the shamrock is hidden just under her shirt. 

 

Marsha


Brian,

I was reading on your site today and saw the woman's post regarding the connection between the cap Casey threw away and 317, or the date 3/17.

 

Attached are two pics of the shamrock tattoo on Casey's back.  In the closeup pic of the tattoo the top part of the shamrock is hidden just under her shirt. 

 

Marsha

 

reply

Thanks Marsha

Brian


Brian,

I have Cindy and R. Anderson out today scouting out and following up on all the tips that have been sent to you.  I have got Beverly’s tip and maps.  They will be following up on that location today also.

I plan on gathering another large group together on Saturday.  I will send you the location and time as soon as it has been determined. 

Wyatt Locke

Search Coordinator

wyatt@

reply

Thanks Wyatt.

Brian


Brian,

 

Here's the link for a video of the woman picking through the Anthony's trash...

http://www.local6.com/news/17435349/detail.html

 

That's where the hat was...

 

Thank you,

 

Carrie

reply

Thanks Carrie...Brian

 

First of all let me say that you guys are doing a wonderful job on the Caylee Anthony case. Second of all I wanted to point out the Lake Gem Mary area there in Orlando. My friend and I were discussing the case tonight as she has relatives who live there in Orlando. Dont know if anyone has checked that area out or not but it might be worth checking out.

 

Thanks I hope this helps in some way...God Bless

 

Sassy

reply

Hi, will forward this to Wyatt.

Brian


Brian, I am getting really discouraged that they will ever find Caylee.  Not that Casey is that brilliant, but the rain conditions have made it more difficult, to her benefit.  You've been on many more of these type cases.  Has this gone on too long?  Are our odds going down each week this continues?   I would have loved to ask NG's guest Nate his gut feelings since he has spent time with her.

Audrey

reply

Hi, I'm no expert and the odds are against us with everyday that goes by...but if she is somewhere in the Orlando area, I think she will be found in the next week or so...actually I thought she was have been found weeks ago.   If TES can stay...they have a greater chance of finding her than anyone else.

Brian


9.12.2008: PERSONAL ISSUES...

Sparked by a Channel 9 news report In Orlando, it seems that several websites have decided to rally their readers into taking psychical action against several members of the TEAM...by encouraging it's readers to visit Gale's and my homes to voice their cause  in person.  They posted our home address along with driving directions and phone numbers...since then Gale been the victim of several crimes, to include rocks being throw at her home...and my truck tire was slashed.  This is where I have to draw the line...and it's not acceptable...I have a wife and three children I will protect them with my life.  Gale's filed a police report and they are investigating...I have other ways in dealing with issues like this. 

I'm sorry to say that I'm closing the public case as of today...I have opened a section for people concerned about the current search and it's located here.   Wyatt's team is having a big search tomorrow, and if anyone wishes to precipitate in the search, please content Wyatt asap.  They are going to continue to search for Caylee until she is brought home...regardless of what other search parties are doing.   We are aware of risks involved with searching, and we think that locals know this area and conditions better than anyone else.  If you do not think you're physically up to the search, please let Wyatt know, as I'm sure he could still use your help.

All work up until today will remain public, and so will the audio recordings and map...everything from this point on, will be private, unless it involves an active search.

Brian


10.16.2008

note from page 5

"Ok, it seems that we've filtered out those readers who intentions are not to find Caylee, but to cause trouble.  I'm guessing that 99% of the people reading this now are here for one reason...and I no longer see the need to keep this case log private.  So starting right now, page 6 and beyond will no longer require a password to view.  All temp case logons given out will be removed tomorrow, so if you're not a site member and there is something you wish save from pages 4 and 5, please do so now.  I do not have a problem for anyone wishing to make copies of these 2 pages for personal / educational use.  And as always, site membership is can be obtained by donating any amount to any chairty...we just need to verify who you are."

Brian


11.8.2008

Pages 4 and 5 are now public. (and will stay public if my home is no longer attacked)

next page

 

Caylee Marie Anthony (located, page 3)

case links: page 1 - page 2 - page 3 - page 4 - page 5 - page 6 - page 7 -page 8 - page 9 -  Nancy Grace / Additional Info - radio show - forum

page 1page 2 - page 3 - page 4 - full list with pics - alphabetical order - correct cases - team archives - chat link - case video archives

 

  

PAGE 1 | PAGE 2 | PAGE 3 | PAGE 4 | ALPHABETICAL ORDER | FULL LIST WITH PICS | CORRECT CASES | MP TV | POST INFORMATION ABOUT THIS CASE | TEAMWORK CASE ARCHIVES | MISSING PERSONS RADIO | MP NEWS | OTHER RV'S | FBI TOP 10 | PLEASE HELP, JOIN THE FORUM FOR THIS CASE CLICK HERE REQUEST TO OPEN A NEW CASE  |  MP WEBSITES

your podcast directory on your mobile Listen to us on your mobile phone    Subscribe in a reader MissingPersonsRadio Missing Person's Radio

 




dream links and dream's only search search tools

For the lasted information on my dreams, please visit my Dream Forum here, or see below for the very latest posts.

all dreams - dreams this year - this month - this week - last night - top 10 - correct - thumbnails - dream forum - dream cures - tell-a-friend

 

Additional Site Information and Links

 

Click below to view my nightly Missing Persons TV Show and Dream Talk with Brian Ladd and Debra Brink - Click here to access my Dream Forum now.

 


Missing Person's TV Show Feed | Missing Person's Radio Feed


View all my TV Shows here!

Site Links

Home - Sharing Hope News - Become a Member - Subliminal Store - Natural Cures and Home Remedies CD Collection - More About Me - Video Chat Rooms - Video ArchivesDream Forum - Radio Blog TalkMySpace - Facebook - Site News - Popular Dreams that have come true - Verified / Correct Dreams - Last night's dreamsDreams this month - Dreams archives - Dream Thumbnails - Missing Persons Section - Missing Person Forum - Missing Persons Radio - Missing Person's TV - Missing Database - Domains - Remote/Brian/Dream Viewing - Edgar Cayce - COA Forum - Free dream newsletter - Contact meInvention dreams - Spread the word - Reader's letters and comments - Request a dream/pillow viewing - Proof of God and the Human Soul - Secrets - Dream CuresFBI's Most Wanted - Help Wanted - Gale St. John - Sitemap - Video RSS Feed - Swine Flu (H1N1) Forum - FindJessie.com - FindAdji.com - FindCindy.com - ClearTVNetwork.com - JusticeforRobert - JusticeForHaleigh.com - Angels are Missing Website - Jacque - E.S.P.I. TV - Stickam - Site Map - Ghost Hunting - XML 

hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHFNBSHMVVWDMFSPVLDDDDDMMMMMDRECFCI SRRDPSDFHSVBLIPRSSM

___________________________________________________________________________